PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KFK26990.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Arabideae; Arabis
Family GRF
Protein Properties Length: 342aa    MW: 37733.4 Da    PI: 8.5374
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KFK26990.1genomeMPIPBRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC76.72.4e-24110153245
         WRC   2 aepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkskee 45 
                  epgrCrRtDGKkWRCs++v++++k+CErHlhrgr rsrk++e+
  KFK26990.1 110 LEPGRCRRTDGKKWRCSKEVVSNHKYCERHLHRGRPRSRKHVEP 153
                 69***************************************997 PP

2QLQ52.21.9e-185989232
         QLQ  2 aFTaaQlqlLksQilAyKyLaanqPvPpeLl 32
                +FT+aQl +L++Q+++yKy++a++PvP +Ll
  KFK26990.1 59 PFTNAQLKELERQAMIYKYMIASVPVPFDLL 89
                9****************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009511.2E-105894IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166618.6455994IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088801.2E-115989IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.182109153IPR014977WRC domain
PfamPF088791.6E-19111152IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0010114Biological Processresponse to red light
GO:0010218Biological Processresponse to far red light
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MDFLKVSDKT TTIPCTSDSL FGLNEQQFGF RDMEIHPPHP HLITPYAGNG VLGCYYYYPF  60
TNAQLKELER QAMIYKYMIA SVPVPFDLLI SSSSSSSVSP CNNKNIAGDL EPGRCRRTDG  120
KKWRCSKEVV SNHKYCERHL HRGRPRSRKH VEPPYSRPIN NNGASEKNRN FPQKLSVKEP  180
KEVSISSSLS NYKESRAKTE EENKYLNFID IWSEKRSTTS TPVSSSNGNL SLYSLDLSMG  240
GGGNNLMGHD EMGLIQMGLG IIGSGREDPY GVSSLEEMSS WLAPKSATPG GPLAEILRPN  300
PSFVFSGGME SYSVTATATP SSSPSRVVKK INGSVSDESS HI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002864265.10.0AtGRF7
SwissprotQ9FJB81e-179GRF7_ARATH; Growth-regulating factor 7
TrEMBLA0A087GAT80.0A0A087GAT8_ARAAL; Uncharacterized protein
STRINGscaffold_801857.10.0(Arabidopsis lyrata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM121062731
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G53660.11e-133growth-regulating factor 7